(data stored in ACNUC7421 zone)

EMBL: CP000438.PE337

CP000438.PE337       Location/Qualifiers
FT   CDS             complement(375633..377027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04210"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15285"
FT                   /db_xref="GOA:A0A0H2ZJX0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX0"
FT                   /protein_id="ABJ15285.1"
FT                   /translation="MASQRNNGILIGGKRPEYVHSAQGTGLRRILGLPALVFFGLVYMV
FT                   PLTMFTTYGVVTEITGGRTASAYLITLAAMLFTAFSYSFMVKKYPIAGSAYSYTSLSFG
FT                   PCVGFLAGWSLLLDYLFLPMINYLLIGLFLNIAFPMVPAWVFVLTAIGLVTVLNVIGIS
FT                   SVAGMSNVIVGAQFVFAVVFVAMAVKHLAGIPSLDLSLPFVGDGSQPGFAPLMAGAAVL
FT                   CLSFLGFDAVSTLAEETRDPQRDIPRAIVITTVGAGLLFTVLAVFSQLVFPGSVFQDAE
FT                   SAANEVMLAAGGKFLASFFTAAYVAGAAGSALASQASVSRILYSMGRDGILPRRVFGSL
FT                   SERFKTPVIAILVVSVISLLAVVIDLTTLASMISFGALVAFSAVNLAVIRSYLLLDGRR
FT                   APRDLLRYGLVPAIGLGLTLWLWTSLSALTLVIGLTWFAAGLAYLALHTGGFRRKAPTV
FT                   TFSEQN"
     MASQRNNGIL IGGKRPEYVH SAQGTGLRRI LGLPALVFFG LVYMVPLTMF TTYGVVTEIT        60
     GGRTASAYLI TLAAMLFTAF SYSFMVKKYP IAGSAYSYTS LSFGPCVGFL AGWSLLLDYL       120
     FLPMINYLLI GLFLNIAFPM VPAWVFVLTA IGLVTVLNVI GISSVAGMSN VIVGAQFVFA       180
     VVFVAMAVKH LAGIPSLDLS LPFVGDGSQP GFAPLMAGAA VLCLSFLGFD AVSTLAEETR       240
     DPQRDIPRAI VITTVGAGLL FTVLAVFSQL VFPGSVFQDA ESAANEVMLA AGGKFLASFF       300
     TAAYVAGAAG SALASQASVS RILYSMGRDG ILPRRVFGSL SERFKTPVIA ILVVSVISLL       360
     AVVIDLTTLA SMISFGALVA FSAVNLAVIR SYLLLDGRRA PRDLLRYGLV PAIGLGLTLW       420
     LWTSLSALTL VIGLTWFAAG LAYLALHTGG FRRKAPTVTF SEQN                        464
//

If you have problems or comments...

PBIL Back to PBIL home page