(data stored in ACNUC7421 zone)

EMBL: CP000438.PE338

CP000438.PE338       Location/Qualifiers
FT   CDS             complement(377448..378491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04220"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15286"
FT                   /db_xref="GOA:A0A0H2ZKV5"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV5"
FT                   /protein_id="ABJ15286.1"
FT                   /translation="MTYRTPLTLLFAAGLALGGQARAEGTLHFANWSDYYPPELLKKFE
FT                   KDTGIKATLDAYDSNETLLAKLKAGGGAYDVVVPSDSFIEIFVKEGLLQKLDKSQLPSL
FT                   GNLKENFRTLGFDPGHDYSIPYLWGTTGYSYDTAKVPGGRLEESWKPFFEPPAELKGKV
FT                   VALNSIEELFIPATYYLGIDECTEDAREAQKVLDLLLRQKPALAMYNSDGTIERMAAGE
FT                   VAMHQQWNGAFHRAHAQRPSLEYVYPKEGIRLFIDNFAIPRDASNVKEAHVFIDWMMRP
FT                   ENIAAASNFAKYNNAIVGSEKFMEKALFDDPAINTPQDKLNRLKPFKLCSPKALALRSK
FT                   VWTKLKK"
     MTYRTPLTLL FAAGLALGGQ ARAEGTLHFA NWSDYYPPEL LKKFEKDTGI KATLDAYDSN        60
     ETLLAKLKAG GGAYDVVVPS DSFIEIFVKE GLLQKLDKSQ LPSLGNLKEN FRTLGFDPGH       120
     DYSIPYLWGT TGYSYDTAKV PGGRLEESWK PFFEPPAELK GKVVALNSIE ELFIPATYYL       180
     GIDECTEDAR EAQKVLDLLL RQKPALAMYN SDGTIERMAA GEVAMHQQWN GAFHRAHAQR       240
     PSLEYVYPKE GIRLFIDNFA IPRDASNVKE AHVFIDWMMR PENIAAASNF AKYNNAIVGS       300
     EKFMEKALFD DPAINTPQDK LNRLKPFKLC SPKALALRSK VWTKLKK                     347
//

If you have problems or comments...

PBIL Back to PBIL home page