(data stored in ACNUC7421 zone)

EMBL: CP000438.PE34

CP000438.PE34        Location/Qualifiers
FT   CDS             complement(35926..36291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00420"
FT                   /product="putative histidine phosphotransfer domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14990"
FT                   /db_xref="GOA:A0A0H2ZJV3"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJV3"
FT                   /protein_id="ABJ14990.1"
FT                   /translation="MRTFDLTAALGDRANQPEISRLLVAQLMTSNNEDTRKLRRAQERE
FT                   QTQELNELAHRLAGMASLIHAHAVERACHQLEIACGESSVRKLADAVDDLVTALGELQC
FT                   ELHDWMTMTAPQGTAKS"
     MRTFDLTAAL GDRANQPEIS RLLVAQLMTS NNEDTRKLRR AQEREQTQEL NELAHRLAGM        60
     ASLIHAHAVE RACHQLEIAC GESSVRKLAD AVDDLVTALG ELQCELHDWM TMTAPQGTAK       120
     S                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page