(data stored in ACNUC7421 zone)

EMBL: CP000438.PE343

CP000438.PE343       Location/Qualifiers
FT   CDS             complement(382631..384574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04290"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15291"
FT                   /db_xref="GOA:A0A0H2ZKW1"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW1"
FT                   /protein_id="ABJ15291.1"
FT                   /translation="MFKPLAVAVGLGCAALSLGANAYQYGEYAGETLERLITDYPGRYR
FT                   GTASFAGASELMQSRLGFGYQTSRQDFTWAGNRSSQNVIASAPGSSGKFLVLGAHYDTY
FT                   YGRPTLQGLDDNASGAAVLTEIARNLGGIALENGLEVVGFGAEEEGLRGSRAYVESLDA
FT                   SQRANLLGMINLDSLVTGDKMYAHAGSNSVSNPALGAYREQILRIARELDIPLFTNPGL
FT                   NAEYPAGTGCCSDGESFNGMDIPVLFIEATNWELGDLDGYEQTDNPAIPGGSTWHDPAE
FT                   DNKEVLTNALGQERIEQRMRDFSRLLTRLVLELTNADLLASTASGGALARQMEDQLQRQ
FT                   HQALTRLHDRRWLTLLGSNRPVGSFDGEVGAEGEVSPDSGFDMPGDPESRRAGVHLLGD
FT                   YRYSEALTLGGSLAFQRSRDKLDHGGRIEGDTWQLGLFGLYNDGGPEWLAGELNLGHTR
FT                   YDSKRSVYLQAAGGPVLLDQRLSGDTSAWSWGARLEGGYDFSFGELRSGPLAGLDYMRY
FT                   RIDDFREDEALRTALGYEKQDYDSLEASLGWRLRGELALGARMRLQPYASLRWVRELAD
FT                   GRLEDMDLTSRGDGRVRVADMGGVDKDFGRAQLGAQLAITEQLGVFAEANSRFAHSEGN
FT                   QAGYSLGVNWQF"
     MFKPLAVAVG LGCAALSLGA NAYQYGEYAG ETLERLITDY PGRYRGTASF AGASELMQSR        60
     LGFGYQTSRQ DFTWAGNRSS QNVIASAPGS SGKFLVLGAH YDTYYGRPTL QGLDDNASGA       120
     AVLTEIARNL GGIALENGLE VVGFGAEEEG LRGSRAYVES LDASQRANLL GMINLDSLVT       180
     GDKMYAHAGS NSVSNPALGA YREQILRIAR ELDIPLFTNP GLNAEYPAGT GCCSDGESFN       240
     GMDIPVLFIE ATNWELGDLD GYEQTDNPAI PGGSTWHDPA EDNKEVLTNA LGQERIEQRM       300
     RDFSRLLTRL VLELTNADLL ASTASGGALA RQMEDQLQRQ HQALTRLHDR RWLTLLGSNR       360
     PVGSFDGEVG AEGEVSPDSG FDMPGDPESR RAGVHLLGDY RYSEALTLGG SLAFQRSRDK       420
     LDHGGRIEGD TWQLGLFGLY NDGGPEWLAG ELNLGHTRYD SKRSVYLQAA GGPVLLDQRL       480
     SGDTSAWSWG ARLEGGYDFS FGELRSGPLA GLDYMRYRID DFREDEALRT ALGYEKQDYD       540
     SLEASLGWRL RGELALGARM RLQPYASLRW VRELADGRLE DMDLTSRGDG RVRVADMGGV       600
     DKDFGRAQLG AQLAITEQLG VFAEANSRFA HSEGNQAGYS LGVNWQF                     647
//

If you have problems or comments...

PBIL Back to PBIL home page