(data stored in ACNUC7421 zone)

EMBL: CP000438.PE344

CP000438.PE344       Location/Qualifiers
FT   CDS             complement(384875..385207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15292"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKQ5"
FT                   /protein_id="ABJ15292.1"
FT                   /translation="MAAKFHLKKAKDGQFHFNLHAANGEIILTSELYKAKDSALGGIES
FT                   VRKNSQRDGAFEVKPANNGKFHFVLKATNGQVVGQSQLYASQANAEAGVQSVKRAAPEA
FT                   GLSDES"
     MAAKFHLKKA KDGQFHFNLH AANGEIILTS ELYKAKDSAL GGIESVRKNS QRDGAFEVKP        60
     ANNGKFHFVL KATNGQVVGQ SQLYASQANA EAGVQSVKRA APEAGLSDES                  110
//

If you have problems or comments...

PBIL Back to PBIL home page