(data stored in ACNUC7421 zone)

EMBL: CP000438.PE347

CP000438.PE347       Location/Qualifiers
FT   CDS             387894..388361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04330"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15295"
FT                   /db_xref="GOA:A0A0H2ZKD8"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD8"
FT                   /protein_id="ABJ15295.1"
FT                   /translation="MEHFLQIKILHGVATVLLFGGLLGLAFYAWRSWRTGDAARIARGF
FT                   KRVRLIGWPLLGLSLLALPVSGWWLVHLAGWPLGQSWLLFGACLYLLGCIFWLVLAGRL
FT                   ARVQHQAGAAETAGAALGEQTLREIKVGLVMALLGAASFIAVAVLMVSKPL"
     MEHFLQIKIL HGVATVLLFG GLLGLAFYAW RSWRTGDAAR IARGFKRVRL IGWPLLGLSL        60
     LALPVSGWWL VHLAGWPLGQ SWLLFGACLY LLGCIFWLVL AGRLARVQHQ AGAAETAGAA       120
     LGEQTLREIK VGLVMALLGA ASFIAVAVLM VSKPL                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page