(data stored in ACNUC7421 zone)

EMBL: CP000438.PE354

CP000438.PE354       Location/Qualifiers
FT   CDS             395075..396205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04420"
FT                   /product="putative sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15302"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY5"
FT                   /protein_id="ABJ15302.1"
FT                   /translation="MRRLRFPRKRIDCLPFGRGHWPVERARDCRKMDERASKPPGLLPL
FT                   SREDLEKTLRYALEIVSDGIWDWNIATNQVSRSAGWYLMLGYPPHSLPESVETWKNIIH
FT                   PEDYPRVMASFQAYLDGESPEYCEEYRCRTYSGDYLWISDRGRFVEFDERGEPRRMIGA
FT                   HHEIHQRKLVELELQQRNEELFDWNRRLEDLVAERTEALHRVNQALASKMAEAQRLSEI
FT                   DPLTELYNRRKFEQCLHHEWMRRQRHGRATALMMIDVDHFKRINDLFGHSTGDRVLVAF
FT                   GRLVASELREVDVLARWGGEEFILLLPETGLEAAAALAERLRQRVRSQSFEMGERLTAS
FT                   FGVGVLNDGETLDLLLCRVDDALYRAKQRRDCVACC"
     MRRLRFPRKR IDCLPFGRGH WPVERARDCR KMDERASKPP GLLPLSREDL EKTLRYALEI        60
     VSDGIWDWNI ATNQVSRSAG WYLMLGYPPH SLPESVETWK NIIHPEDYPR VMASFQAYLD       120
     GESPEYCEEY RCRTYSGDYL WISDRGRFVE FDERGEPRRM IGAHHEIHQR KLVELELQQR       180
     NEELFDWNRR LEDLVAERTE ALHRVNQALA SKMAEAQRLS EIDPLTELYN RRKFEQCLHH       240
     EWMRRQRHGR ATALMMIDVD HFKRINDLFG HSTGDRVLVA FGRLVASELR EVDVLARWGG       300
     EEFILLLPET GLEAAAALAE RLRQRVRSQS FEMGERLTAS FGVGVLNDGE TLDLLLCRVD       360
     DALYRAKQRR DCVACC                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page