(data stored in ACNUC7421 zone)

EMBL: CP000438.PE355

CP000438.PE355       Location/Qualifiers
FT   CDS             complement(396209..396964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15303"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW9"
FT                   /protein_id="ABJ15303.1"
FT                   /translation="MCLIVFAWQPGHALPLLVAANRDEFYARPSLPLAAWEDAEGVFAG
FT                   RDLEAGGTWLGLGPAGRFAALTNVRDPSQALGKRSRGELVADFLRGGGNPADYLAQVAG
FT                   RAADYSGFNLLIGDRHQLWHYNPRVGPPRLLPAGVYGLSNAALDTPWPKLLKARAALAE
FT                   RLAEPHPQALLELLADAAPAADSQLPDTGVGLATERLLSSVFIASPSYGTRASSVVRVH
FT                   ADGTREMIERSFGPSGARLGEVSLVLPPG"
     MCLIVFAWQP GHALPLLVAA NRDEFYARPS LPLAAWEDAE GVFAGRDLEA GGTWLGLGPA        60
     GRFAALTNVR DPSQALGKRS RGELVADFLR GGGNPADYLA QVAGRAADYS GFNLLIGDRH       120
     QLWHYNPRVG PPRLLPAGVY GLSNAALDTP WPKLLKARAA LAERLAEPHP QALLELLADA       180
     APAADSQLPD TGVGLATERL LSSVFIASPS YGTRASSVVR VHADGTREMI ERSFGPSGAR       240
     LGEVSLVLPP G                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page