(data stored in ACNUC7421 zone)

EMBL: CP000438.PE359

CP000438.PE359       Location/Qualifiers
FT   CDS             complement(399726..400523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15307"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL35"
FT                   /protein_id="ABJ15307.1"
FT                   /translation="MPFVSYAQNLEDVRLWRALKLFPRGFYIDVGANHPRIDSVTLAFY
FT                   ERGWRGINIEPLPHLHRELERERPEDLNLNLAIGEREGRATLYEMAASGLSTLDPELAR
FT                   QRQAEGCTATPREVMVSTLDAICAAHVEGPIHFLKIDVEGLEGAVLRGLDLNRWRPWLI
FT                   LAETPFDHDPEWKAPLLAAGYRFVHFDGLNGYYLAEEQARLEGAFALPPNLLDDFQLCH
FT                   GHAMSHPVAPLEQALEQALQRAEDAERALRDWRALPWYRRLFG"
     MPFVSYAQNL EDVRLWRALK LFPRGFYIDV GANHPRIDSV TLAFYERGWR GINIEPLPHL        60
     HRELERERPE DLNLNLAIGE REGRATLYEM AASGLSTLDP ELARQRQAEG CTATPREVMV       120
     STLDAICAAH VEGPIHFLKI DVEGLEGAVL RGLDLNRWRP WLILAETPFD HDPEWKAPLL       180
     AAGYRFVHFD GLNGYYLAEE QARLEGAFAL PPNLLDDFQL CHGHAMSHPV APLEQALEQA       240
     LQRAEDAERA LRDWRALPWY RRLFG                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page