(data stored in ACNUC7421 zone)

EMBL: CP000438.PE360

CP000438.PE360       Location/Qualifiers
FT   CDS             complement(400558..401937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15308"
FT                   /db_xref="GOA:A0A0H2ZKE6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE6"
FT                   /protein_id="ABJ15308.1"
FT                   /translation="MTEPLILAVVGHTNTGKTSLLRTLTRDRGFGEVSHRPSTTRHVEG
FT                   ARLSVDGEALLELYDTPGLEDAIALLDYLDALERPGERLDGPERMARLLDSNEARGRFE
FT                   QEAKVVRQLLASDAGLYVIDAREPVLAKYRDELAVLAGCGRPLLPVLNFVASPQHREEE
FT                   WRAALARLGLHALVRFDSVAPPLDGERRLYESLALLLERARPQLDRLIADHETQAAARL
FT                   RAGQRLIAELLVDVAACRRLVPGGESAVQEATRDLHQQVRKREQACVEALLRLYAFARD
FT                   DARAADLPLLDGRWGDDLFNPETLRQLGIRLGGGVAAGAAAGAGIDLLVGGVTLGAAAA
FT                   LGALAGGAWQTVGHYGSRLLGKLKGARELTVNDAVLRLLALRQRQLLAALQTRGHAAIE
FT                   AIRLETPEDKQWREGKLPEALRKARAHPEWSSLNGRRVGGSDRQEQIDALAELLESGRG
FT                   E"
     MTEPLILAVV GHTNTGKTSL LRTLTRDRGF GEVSHRPSTT RHVEGARLSV DGEALLELYD        60
     TPGLEDAIAL LDYLDALERP GERLDGPERM ARLLDSNEAR GRFEQEAKVV RQLLASDAGL       120
     YVIDAREPVL AKYRDELAVL AGCGRPLLPV LNFVASPQHR EEEWRAALAR LGLHALVRFD       180
     SVAPPLDGER RLYESLALLL ERARPQLDRL IADHETQAAA RLRAGQRLIA ELLVDVAACR       240
     RLVPGGESAV QEATRDLHQQ VRKREQACVE ALLRLYAFAR DDARAADLPL LDGRWGDDLF       300
     NPETLRQLGI RLGGGVAAGA AAGAGIDLLV GGVTLGAAAA LGALAGGAWQ TVGHYGSRLL       360
     GKLKGARELT VNDAVLRLLA LRQRQLLAAL QTRGHAAIEA IRLETPEDKQ WREGKLPEAL       420
     RKARAHPEWS SLNGRRVGGS DRQEQIDALA ELLESGRGE                              459
//

If you have problems or comments...

PBIL Back to PBIL home page