(data stored in ACNUC7421 zone)

EMBL: CP000438.PE361

CP000438.PE361       Location/Qualifiers
FT   CDS             complement(401930..403315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04520"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15309"
FT                   /db_xref="GOA:A0A0H2ZJZ2"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ2"
FT                   /protein_id="ABJ15309.1"
FT                   /translation="MSHTTHPGLDALWLTEAVRLREEQAGPLEDSEALRQALAQGGSLP
FT                   RRILTRAHWLGRREGLLDAQRTWRQGSRLALALLLVLALASGAGLAFAALGDGQRPVNV
FT                   FWALASLLGLHLLTLLGWALGLLAGGEAAGALGRLWLWLSGKLARDARAAHLAPALLVL
FT                   LGRRRLARWGLGALVHGLWLLGLLTALAMLLGLLATRRYGFVWETTILGSDTFIALTQA
FT                   LGALPALLGFPLPDAELIRASGDAALASEAARHAWAGWLVGVLLVYGVLPRALLGLFCL
FT                   WRWKRGLADLDLDLDDPGYSLLRERLMPASERLGVSDAAPDWLPEPQGGQSGQEAAGAV
FT                   LVAVELDDRRPWPPKLAEGVADAGILDDGQQRRRLLDQLTRYPPARLAIACDPRRSPDR
FT                   GTLALLGELARCAASTRIWLLQAPPGEALDSDRLGDWHTALERLQLPHGETSPLAWLET
FT                   GHD"
     MSHTTHPGLD ALWLTEAVRL REEQAGPLED SEALRQALAQ GGSLPRRILT RAHWLGRREG        60
     LLDAQRTWRQ GSRLALALLL VLALASGAGL AFAALGDGQR PVNVFWALAS LLGLHLLTLL       120
     GWALGLLAGG EAAGALGRLW LWLSGKLARD ARAAHLAPAL LVLLGRRRLA RWGLGALVHG       180
     LWLLGLLTAL AMLLGLLATR RYGFVWETTI LGSDTFIALT QALGALPALL GFPLPDAELI       240
     RASGDAALAS EAARHAWAGW LVGVLLVYGV LPRALLGLFC LWRWKRGLAD LDLDLDDPGY       300
     SLLRERLMPA SERLGVSDAA PDWLPEPQGG QSGQEAAGAV LVAVELDDRR PWPPKLAEGV       360
     ADAGILDDGQ QRRRLLDQLT RYPPARLAIA CDPRRSPDRG TLALLGELAR CAASTRIWLL       420
     QAPPGEALDS DRLGDWHTAL ERLQLPHGET SPLAWLETGH D                           461
//

If you have problems or comments...

PBIL Back to PBIL home page