(data stored in ACNUC7421 zone)

EMBL: CP000438.PE362

CP000438.PE362       Location/Qualifiers
FT   CDS             403507..403869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15310"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX5"
FT                   /protein_id="ABJ15310.1"
FT                   /translation="MKVVRRYPLALLLGMAGALADELPDGSLLQRYGVQADQLPTLAAD
FT                   PPSRKEEKETPSRFRVEPEQPLVTFGVKDHKGVEPTGNLSIDAMHERDRRICRNIRRQA
FT                   LEKGKAQPFDGYIECP"
     MKVVRRYPLA LLLGMAGALA DELPDGSLLQ RYGVQADQLP TLAADPPSRK EEKETPSRFR        60
     VEPEQPLVTF GVKDHKGVEP TGNLSIDAMH ERDRRICRNI RRQALEKGKA QPFDGYIECP       120
//

If you have problems or comments...

PBIL Back to PBIL home page