(data stored in ACNUC7421 zone)

EMBL: CP000438.PE364

CP000438.PE364       Location/Qualifiers
FT   CDS             405267..406361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04560"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL38"
FT                   /protein_id="ABJ15312.1"
FT                   /translation="MASAQPASAFPCLSLQLACLLLGAWLAFDAHGGGQAVAPPARVEA
FT                   RVPTAATDDWGRQPDSLMSAVPPRTLEASVGARGSGSASSRLWIADTDFRLHDDIGFFI
FT                   QRMLIRMEPTRPGAPLSLDDPTAMVARIQAGEIFVSDATLATLLNQDLAASRAAVRNLR
FT                   MSTRKDGQEVRGELLRKGRWRPLRMLTEIELSGPLEVTLVPRRIFVDGVEVTSSLAAAS
FT                   IEMSEVLKLKTRHMELVGNRIRVDLDGLFPPPRLDFRVSRLALADGGMQLALGDSLADL
FT                   QWPALRAPDSYMFIEGGDIKMARTVLVKAYALFTSLSPGQPLLFNLYDYRRQLQNGVIR
FT                   LREDGMVQIAVSPVKAPAPLEARL"
     MASAQPASAF PCLSLQLACL LLGAWLAFDA HGGGQAVAPP ARVEARVPTA ATDDWGRQPD        60
     SLMSAVPPRT LEASVGARGS GSASSRLWIA DTDFRLHDDI GFFIQRMLIR MEPTRPGAPL       120
     SLDDPTAMVA RIQAGEIFVS DATLATLLNQ DLAASRAAVR NLRMSTRKDG QEVRGELLRK       180
     GRWRPLRMLT EIELSGPLEV TLVPRRIFVD GVEVTSSLAA ASIEMSEVLK LKTRHMELVG       240
     NRIRVDLDGL FPPPRLDFRV SRLALADGGM QLALGDSLAD LQWPALRAPD SYMFIEGGDI       300
     KMARTVLVKA YALFTSLSPG QPLLFNLYDY RRQLQNGVIR LREDGMVQIA VSPVKAPAPL       360
     EARL                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page