(data stored in ACNUC7421 zone)

EMBL: CP000438.PE365

CP000438.PE365       Location/Qualifiers
FT   CDS             406358..407398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE9"
FT                   /protein_id="ABJ15313.1"
FT                   /translation="MSRRPWGVLLGWCLLAASAVQAESAIDRQQRELALLREGWYRQVP
FT                   PAPVPLPMRTAGPADSGQDGVGILLRNVDMYLRGNIGFHVPEVKGWLVPNRAGQPVDFD
FT                   RPQDIHFQVMEGEVLLSPRQLANLFNEHILAYDGTMLKDFRMSSAAGRLEVEGRVRPLG
FT                   VGPWLPLRLGGGVEVDAASGALVYRPDQLKVIGLPLYGAMSLVGLPMSALVSLDRPGAS
FT                   LVGSAMRLDYRKVFPLLGIDGHVQEAWLDDQGLHLRFSQAPGQPSPVFSPPAAAGPSFL
FT                   WLQSGDLKIFEILITYAQVLLKTETPDQVLTFNLQDYRKVLATGTTQVNEDGTFFMQVP
FT                   PYANPL"
     MSRRPWGVLL GWCLLAASAV QAESAIDRQQ RELALLREGW YRQVPPAPVP LPMRTAGPAD        60
     SGQDGVGILL RNVDMYLRGN IGFHVPEVKG WLVPNRAGQP VDFDRPQDIH FQVMEGEVLL       120
     SPRQLANLFN EHILAYDGTM LKDFRMSSAA GRLEVEGRVR PLGVGPWLPL RLGGGVEVDA       180
     ASGALVYRPD QLKVIGLPLY GAMSLVGLPM SALVSLDRPG ASLVGSAMRL DYRKVFPLLG       240
     IDGHVQEAWL DDQGLHLRFS QAPGQPSPVF SPPAAAGPSF LWLQSGDLKI FEILITYAQV       300
     LLKTETPDQV LTFNLQDYRK VLATGTTQVN EDGTFFMQVP PYANPL                      346
//

If you have problems or comments...

PBIL Back to PBIL home page