(data stored in ACNUC7421 zone)

EMBL: CP000438.PE372

CP000438.PE372       Location/Qualifiers
FT   CDS             414409..415233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04660"
FT                   /product="putative signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15320"
FT                   /db_xref="GOA:A0A0H2ZK04"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK04"
FT                   /protein_id="ABJ15320.1"
FT                   /translation="MPPQPQIMVDLQMEQVMPNPDLKNIARLISQDPGLSGALLKLVNS
FT                   PFFGLANRITSIQRAVNLLGSRSVINLINAQSIKGEMSDDTIVTLNRFWDTAQDVAMSC
FT                   LSLAKRVGYESVDEAYALGLFHNCGIPLMLKRFPHYMAVLEEAYAAASDKRRVVDTENR
FT                   VLNTNHAVVGYYTARSWRLPEHVCEAIANHHNALSIFGDESARDTQLKNLLAILKMAEH
FT                   ICGSHRILGNQPEDHEWNSIGALVLDYVGLTDYDFENLKGSILELGVGQGSY"
     MPPQPQIMVD LQMEQVMPNP DLKNIARLIS QDPGLSGALL KLVNSPFFGL ANRITSIQRA        60
     VNLLGSRSVI NLINAQSIKG EMSDDTIVTL NRFWDTAQDV AMSCLSLAKR VGYESVDEAY       120
     ALGLFHNCGI PLMLKRFPHY MAVLEEAYAA ASDKRRVVDT ENRVLNTNHA VVGYYTARSW       180
     RLPEHVCEAI ANHHNALSIF GDESARDTQL KNLLAILKMA EHICGSHRIL GNQPEDHEWN       240
     SIGALVLDYV GLTDYDFENL KGSILELGVG QGSY                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page