(data stored in ACNUC7421 zone)

EMBL: CP000438.PE375

CP000438.PE375       Location/Qualifiers
FT   CDS             416842..417186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15323"
FT                   /db_xref="GOA:A0A0H2ZKS3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS3"
FT                   /protein_id="ABJ15323.1"
FT                   /translation="MNLFRTTALVLALTTGLSSMPALADAVQENASGDPMYTVEAPPAY
FT                   AMIGDLLIARPFLIAATAVGAVAFVVSLPFTAASGSVGKAGQALVVDPGKEAFVRCLGC
FT                   TTSGYNHDES"
     MNLFRTTALV LALTTGLSSM PALADAVQEN ASGDPMYTVE APPAYAMIGD LLIARPFLIA        60
     ATAVGAVAFV VSLPFTAASG SVGKAGQALV VDPGKEAFVR CLGCTTSGYN HDES             114
//

If you have problems or comments...

PBIL Back to PBIL home page