(data stored in ACNUC7421 zone)

EMBL: CP000438.PE376

CP000438.PE376       Location/Qualifiers
FT   CDS             417456..418442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15324"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL48"
FT                   /protein_id="ABJ15324.1"
FT                   /translation="MFSQWVFLSVLALAVPSFAWAEDAVSDLAKEQSKAEQGDKRGDEL
FT                   FAEFTRLRQAAETGEPQALFDFGAYFYQQQNYASAREWWGKAAAAGMVRAQIQLAMLYR
FT                   DGDGGPQDKTEAARWFRKAAEQGDAAAQNEMGVLYWRGEGVDQDRVKAGTWFERAAASG
FT                   SEDAETNLGWFYLDDSQGVYSATSDEEAALLDRYAGSREKAFQWFCKAATQGDARAQFK
FT                   VGEAYWNGSGAGMNKLQARLWLEKAAQQQDADAIAWLESAANAAWYTRLENWIHAALDG
FT                   ELSGVADCSGVADRRHSGRGMEGASSEPEAVEASAEDAQQAAEAASQ"
     MFSQWVFLSV LALAVPSFAW AEDAVSDLAK EQSKAEQGDK RGDELFAEFT RLRQAAETGE        60
     PQALFDFGAY FYQQQNYASA REWWGKAAAA GMVRAQIQLA MLYRDGDGGP QDKTEAARWF       120
     RKAAEQGDAA AQNEMGVLYW RGEGVDQDRV KAGTWFERAA ASGSEDAETN LGWFYLDDSQ       180
     GVYSATSDEE AALLDRYAGS REKAFQWFCK AATQGDARAQ FKVGEAYWNG SGAGMNKLQA       240
     RLWLEKAAQQ QDADAIAWLE SAANAAWYTR LENWIHAALD GELSGVADCS GVADRRHSGR       300
     GMEGASSEPE AVEASAEDAQ QAAEAASQ                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page