(data stored in ACNUC7421 zone)

EMBL: CP000438.PE377

CP000438.PE377       Location/Qualifiers
FT   CDS             complement(418555..418986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF6"
FT                   /protein_id="ABJ15325.1"
FT                   /translation="MSLFRPLLIASTLALASGCASGLNSQQTAELEYYEARNLAVIEKS
FT                   PGTGAALGLLPGGGSFYGRSYGLGVVNLLFWPLSILWDPVSGYDASQRINYTATRVHLE
FT                   KLRQRDFDELQRLADNGALDGATLARKRQDVETKYRYTP"
     MSLFRPLLIA STLALASGCA SGLNSQQTAE LEYYEARNLA VIEKSPGTGA ALGLLPGGGS        60
     FYGRSYGLGV VNLLFWPLSI LWDPVSGYDA SQRINYTATR VHLEKLRQRD FDELQRLADN       120
     GALDGATLAR KRQDVETKYR YTP                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page