(data stored in ACNUC7421 zone)

EMBL: CP000438.PE382

CP000438.PE382       Location/Qualifiers
FT   CDS             complement(423650..424198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15330"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL54"
FT                   /protein_id="ABJ15330.1"
FT                   /translation="MSDTTLESAGLSRRSLMKVGLIGGAFLATAGVTASLTGCSAEKPA
FT                   SGLEKVRESDLPFLRALLPVMLLGAVSAEQMPKAVEGAIQSLDHNLARLSPEMFKLTQQ
FT                   LFDVLALPLTRGPLTGIWGSWENASGDDVRAFLSRWENSFIGLLRMGHSSLMQLAMMAW
FT                   YARPEAWAHCGYPGPPKIA"
     MSDTTLESAG LSRRSLMKVG LIGGAFLATA GVTASLTGCS AEKPASGLEK VRESDLPFLR        60
     ALLPVMLLGA VSAEQMPKAV EGAIQSLDHN LARLSPEMFK LTQQLFDVLA LPLTRGPLTG       120
     IWGSWENASG DDVRAFLSRW ENSFIGLLRM GHSSLMQLAM MAWYARPEAW AHCGYPGPPK       180
     IA                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page