(data stored in ACNUC7421 zone)

EMBL: CP000438.PE39

CP000438.PE39        Location/Qualifiers
FT   CDS             40211..40426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14995"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIY0"
FT                   /protein_id="ABJ14995.1"
FT                   /translation="MSNHHTYKKIELVGSSKTSIEDAINNALAEAAKSIQHLEWFEVVD
FT                   TRGHIENGAVGHYQVTLKVGFRIANS"
     MSNHHTYKKI ELVGSSKTSI EDAINNALAE AAKSIQHLEW FEVVDTRGHI ENGAVGHYQV        60
     TLKVGFRIAN S                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page