(data stored in ACNUC7421 zone)

EMBL: CP000438.PE395

CP000438.PE395       Location/Qualifiers
FT   CDS             436338..436943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15343"
FT                   /db_xref="GOA:A0A0H2ZL06"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL06"
FT                   /protein_id="ABJ15343.1"
FT                   /translation="MPRNTRWLFYLSLAVLTFVVGAWLVRTPEPARPLPWLADWQEQVL
FT                   APLADNALTLRQLHDAVDGELWVDPRLDGVRLAFRGRLLGDGGPWQVEGELGLSAEEQL
FT                   SLQRASALQPGSAPQPLSAGLEGQLGDKPIVALSMIPEGRVGAERLLASLGQPRLRLQL
FT                   AQGEAWVYPQLGLTAHLPDDDLRLMLAVPRQALEKPPR"
     MPRNTRWLFY LSLAVLTFVV GAWLVRTPEP ARPLPWLADW QEQVLAPLAD NALTLRQLHD        60
     AVDGELWVDP RLDGVRLAFR GRLLGDGGPW QVEGELGLSA EEQLSLQRAS ALQPGSAPQP       120
     LSAGLEGQLG DKPIVALSMI PEGRVGAERL LASLGQPRLR LQLAQGEAWV YPQLGLTAHL       180
     PDDDLRLMLA VPRQALEKPP R                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page