(data stored in ACNUC7421 zone)

EMBL: CP000438.PE397

CP000438.PE397       Location/Qualifiers
FT   CDS             437716..438093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_04960"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15345"
FT                   /db_xref="GOA:A0A0H2ZL73"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL73"
FT                   /protein_id="ABJ15345.1"
FT                   /translation="MLRPFLLLAAFFGFTGVALGAFAAHGLKKQLSAEYLAVFQTGVHY
FT                   QLIHALALFGVALLATRLDGRLVSAAGGLFTLGILLFSGSLYLLTLSGIGKLGIVTPFG
FT                   GVSFLAGWLCLGLAAWRLGNA"
     MLRPFLLLAA FFGFTGVALG AFAAHGLKKQ LSAEYLAVFQ TGVHYQLIHA LALFGVALLA        60
     TRLDGRLVSA AGGLFTLGIL LFSGSLYLLT LSGIGKLGIV TPFGGVSFLA GWLCLGLAAW       120
     RLGNA                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page