(data stored in ACNUC7421 zone)

EMBL: CP000438.PE40

CP000438.PE40        Location/Qualifiers
FT   CDS             40610..40837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14996"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJV9"
FT                   /protein_id="ABJ14996.1"
FT                   /translation="MFMKKLMLAVGLFAVAGSAFAAKPCEELKAEIDAKIKANGVPAYT
FT                   LEIVDKGSVTDKKVVGTCDGGTKEIVYQRG"
     MFMKKLMLAV GLFAVAGSAF AAKPCEELKA EIDAKIKANG VPAYTLEIVD KGSVTDKKVV        60
     GTCDGGTKEI VYQRG                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page