(data stored in ACNUC7421 zone)

EMBL: CP000438.PE401

CP000438.PE401       Location/Qualifiers
FT   CDS             440240..441586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15349"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK31"
FT                   /protein_id="ABJ15349.1"
FT                   /translation="MLKKLGILLLGAGCAWAAQAKVDEVQAARLDQDLTPLGAERAGNA
FT                   DGSIPPWTGGITQAPAGYRPGMHHLDPFAADRPRLVVDSRNMAAYQALLTPGTQALLQA
FT                   NPDYHLRVFPSRRSASLPQRLYDATRANASRAELIADGNGVQGAAAGVPFPLPQSGQEA
FT                   IWNHIMRYRGEQLHLQTNQAAVLANGSYNLLKLDRYLYFVYGREGMIPENLDNTLFYYK
FT                   YKVVAPARLAGSALVVQETLDQVLSIRKAWRFNRGERRVRRLPTLAYDSLQPDTNGMAT
FT                   ADTVDVYNGAPDHYEWALLGKREMLVPYNSYAVHQKGLAYGDILKSRFINPDLLRYELH
FT                   RVWVVEATLRKGFSHPYAKRRFYLDEDSWQILAADIYDKDGVLTRAQEVHPINYYDVPL
FT                   VSSTLEAIYDFKGGRYFVDGLDNNEPMYDFGVQVGPRDFTPQALRREGN"
     MLKKLGILLL GAGCAWAAQA KVDEVQAARL DQDLTPLGAE RAGNADGSIP PWTGGITQAP        60
     AGYRPGMHHL DPFAADRPRL VVDSRNMAAY QALLTPGTQA LLQANPDYHL RVFPSRRSAS       120
     LPQRLYDATR ANASRAELIA DGNGVQGAAA GVPFPLPQSG QEAIWNHIMR YRGEQLHLQT       180
     NQAAVLANGS YNLLKLDRYL YFVYGREGMI PENLDNTLFY YKYKVVAPAR LAGSALVVQE       240
     TLDQVLSIRK AWRFNRGERR VRRLPTLAYD SLQPDTNGMA TADTVDVYNG APDHYEWALL       300
     GKREMLVPYN SYAVHQKGLA YGDILKSRFI NPDLLRYELH RVWVVEATLR KGFSHPYAKR       360
     RFYLDEDSWQ ILAADIYDKD GVLTRAQEVH PINYYDVPLV SSTLEAIYDF KGGRYFVDGL       420
     DNNEPMYDFG VQVGPRDFTP QALRREGN                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page