(data stored in ACNUC7421 zone)

EMBL: CP000438.PE403

CP000438.PE403       Location/Qualifiers
FT   CDS             complement(441918..442241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15351"
FT                   /db_xref="GOA:A0A0H2ZKU4"
FT                   /db_xref="InterPro:IPR021813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU4"
FT                   /protein_id="ABJ15351.1"
FT                   /translation="MDYALDLIATLSRWSRSHLSDISLAIMATLLVLFGPAINAWVQQR
FT                   IGSLNFVFRTLLFVLICAVGYGLAMVFVTPWLAKGLGYFNNYTLAPVLLLVFFVIGMIA
FT                   DRS"
     MDYALDLIAT LSRWSRSHLS DISLAIMATL LVLFGPAINA WVQQRIGSLN FVFRTLLFVL        60
     ICAVGYGLAM VFVTPWLAKG LGYFNNYTLA PVLLLVFFVI GMIADRS                     107
//

If you have problems or comments...

PBIL Back to PBIL home page