(data stored in ACNUC7421 zone)

EMBL: CP000438.PE405

CP000438.PE405       Location/Qualifiers
FT   CDS             complement(443597..444190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05050"
FT                   /product="putative Ham1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15353"
FT                   /db_xref="GOA:A0A0H2ZKH4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH4"
FT                   /protein_id="ABJ15353.1"
FT                   /translation="MIKLEQLVLASHNAGKLKELQAMLGASVKVRSIGEFSQVEPEETG
FT                   LSFVENAILKARNAARLSGLPALADDSGLAVDFLGGAPGIYSARYADGRGDAANNAKLL
FT                   EAMKDVPDAERGAQFVSVLALVRHADDPLPILCEGIWEGRILREARGAHGFGYDPLFWV
FT                   PERDCSSAELAPEEKNRLSHRARAMALLKQRLGL"
     MIKLEQLVLA SHNAGKLKEL QAMLGASVKV RSIGEFSQVE PEETGLSFVE NAILKARNAA        60
     RLSGLPALAD DSGLAVDFLG GAPGIYSARY ADGRGDAANN AKLLEAMKDV PDAERGAQFV       120
     SVLALVRHAD DPLPILCEGI WEGRILREAR GAHGFGYDPL FWVPERDCSS AELAPEEKNR       180
     LSHRARAMAL LKQRLGL                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page