(data stored in ACNUC7421 zone)

EMBL: CP000438.PE406

CP000438.PE406       Location/Qualifiers
FT   CDS             complement(444187..444606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15354"
FT                   /db_xref="InterPro:IPR025218"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK38"
FT                   /protein_id="ABJ15354.1"
FT                   /translation="MRRFTAFVLGLCLSLPVLAEQVQRFGDLDVHYNVFNSSFLQPNVA
FT                   SAVGLVRSKAQGVINVVPMEKGKPVEASVTGSAKDLTGKVIPLEFRRVSEEGAIYNLAQ
FT                   FPISQRETLVFTIKVEAKGEPAQTFSFNKEIFPDE"
     MRRFTAFVLG LCLSLPVLAE QVQRFGDLDV HYNVFNSSFL QPNVASAVGL VRSKAQGVIN        60
     VVPMEKGKPV EASVTGSAKD LTGKVIPLEF RRVSEEGAIY NLAQFPISQR ETLVFTIKVE       120
     AKGEPAQTFS FNKEIFPDE                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page