(data stored in ACNUC7421 zone)

EMBL: CP000438.PE409

CP000438.PE409       Location/Qualifiers
FT   CDS             complement(446594..448561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15357"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU7"
FT                   /protein_id="ABJ15357.1"
FT                   /translation="MSMERLSHQIDAYVAWKRELMREITRYRGWLERSRLNSPAVEAKL
FT                   ERALRQLRADHITLAFVGEFSRGKTELINSLFFAGYGQRMLPSHAGRTTMCPTELFHDP
FT                   RAERSYIRLLPIETRLADASVAQFKRVPRHWVNIPLDTGDPEGMAQAFAQVAKTKALPV
FT                   EQAIQLGFHPDALEAADEPDQVRVPAWRHALVNFDHPLLRQGLRILDTPGLNALGSEPE
FT                   LTLSMLPNAQAILFLLSADAGVTASDMEIWQKYIQPLREDGHSSLFAVLNKIDVLWDDL
FT                   SGERFVQNAIRLIQDGTARQLGLQRGDVLPLSAKQALLAKVRGEPALLERSRLDRLEAL
FT                   LCERIVAQKEALLENAVLGQVLGLLHNSQHLLRLRLEKVEEQRALLDDKQRDSGQLLFE
FT                   LTAKTKDDHGRHHRRLLNLKTNQRLLQHQGATLRETIRSERMEQHLQKVRRNLNGSLTT
FT                   VGINQAILAFFRAVEHDLDNLEHEAGMANRMVAAIYRRHNEENPLYALDAPQLRVQRYQ
FT                   RELLQLKKKGDQFRLQLKTVLTEQRLLTRRFFATLVQEVVGLHQRLREETERWANDALM
FT                   PLMQHTLENKQLLESHMLRLKGLAQETQQVRQRSQAFAGFAEELQEQLREAGDILRQLR
FT                   RPSPLQRQAKVVNLPGSQRA"
     MSMERLSHQI DAYVAWKREL MREITRYRGW LERSRLNSPA VEAKLERALR QLRADHITLA        60
     FVGEFSRGKT ELINSLFFAG YGQRMLPSHA GRTTMCPTEL FHDPRAERSY IRLLPIETRL       120
     ADASVAQFKR VPRHWVNIPL DTGDPEGMAQ AFAQVAKTKA LPVEQAIQLG FHPDALEAAD       180
     EPDQVRVPAW RHALVNFDHP LLRQGLRILD TPGLNALGSE PELTLSMLPN AQAILFLLSA       240
     DAGVTASDME IWQKYIQPLR EDGHSSLFAV LNKIDVLWDD LSGERFVQNA IRLIQDGTAR       300
     QLGLQRGDVL PLSAKQALLA KVRGEPALLE RSRLDRLEAL LCERIVAQKE ALLENAVLGQ       360
     VLGLLHNSQH LLRLRLEKVE EQRALLDDKQ RDSGQLLFEL TAKTKDDHGR HHRRLLNLKT       420
     NQRLLQHQGA TLRETIRSER MEQHLQKVRR NLNGSLTTVG INQAILAFFR AVEHDLDNLE       480
     HEAGMANRMV AAIYRRHNEE NPLYALDAPQ LRVQRYQREL LQLKKKGDQF RLQLKTVLTE       540
     QRLLTRRFFA TLVQEVVGLH QRLREETERW ANDALMPLMQ HTLENKQLLE SHMLRLKGLA       600
     QETQQVRQRS QAFAGFAEEL QEQLREAGDI LRQLRRPSPL QRQAKVVNLP GSQRA            655
//

If you have problems or comments...

PBIL Back to PBIL home page