(data stored in ACNUC7421 zone)

EMBL: CP000438.PE41

CP000438.PE41        Location/Qualifiers
FT   CDS             41133..42821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00490"
FT                   /product="putative hemolysin activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14997"
FT                   /db_xref="GOA:A0A0H2ZJZ8"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ8"
FT                   /protein_id="ABJ14997.1"
FT                   /translation="MALHRLAFIFLCLPLMASAAPFTSPGDRDLIRDRQQRLLDEQRKR
FT                   LEELQQLPGKGAPAAADASGDDERCFEIRRIEMEGAGHLGESARRQLLAPYQGRCLGVG
FT                   QLNALLKAVTDHYLDRGYVTTRAYLPQQDLASGTLRIIVVEGRLEGLDSSALASPRELA
FT                   MSFPGRTGELLDLRELEQLVDQLSRLPSRQAQLELVPGSEVGGSRVRLKGERDKPWRVS
FT                   ATRNNDGDVSTGEQQMGLGLDWDSPLGLADQLNLRANRDAVTDRWRHSDSQSLFYSLPW
FT                   GWWTFTYGYSQSDYRTRNEASGFPFKLDGDSRSHQFRAERVLHRDGVSKTAMSLGLSHQ
FT                   RTNNYVEDTRLEDQSTRITETQLGFNHGRRIGSGFVNLDLGWQQGIGALGAQGRGHPQA
FT                   GDPNARYDKYSLTLSYLQPFQLWGERFSFDSLATGQRSEDVLFSPQRISLGGNSSVRGF
FT                   KDQTLTGDSGGYWRNQLRWRRAVEWAPLRPWLQEYGVAFAYDVGVIRHDRYNDGASGRM
FT                   SGNAIELDARGRYFAASVGFARSLERPSAIERREHPIYFRVDAFF"
     MALHRLAFIF LCLPLMASAA PFTSPGDRDL IRDRQQRLLD EQRKRLEELQ QLPGKGAPAA        60
     ADASGDDERC FEIRRIEMEG AGHLGESARR QLLAPYQGRC LGVGQLNALL KAVTDHYLDR       120
     GYVTTRAYLP QQDLASGTLR IIVVEGRLEG LDSSALASPR ELAMSFPGRT GELLDLRELE       180
     QLVDQLSRLP SRQAQLELVP GSEVGGSRVR LKGERDKPWR VSATRNNDGD VSTGEQQMGL       240
     GLDWDSPLGL ADQLNLRANR DAVTDRWRHS DSQSLFYSLP WGWWTFTYGY SQSDYRTRNE       300
     ASGFPFKLDG DSRSHQFRAE RVLHRDGVSK TAMSLGLSHQ RTNNYVEDTR LEDQSTRITE       360
     TQLGFNHGRR IGSGFVNLDL GWQQGIGALG AQGRGHPQAG DPNARYDKYS LTLSYLQPFQ       420
     LWGERFSFDS LATGQRSEDV LFSPQRISLG GNSSVRGFKD QTLTGDSGGY WRNQLRWRRA       480
     VEWAPLRPWL QEYGVAFAYD VGVIRHDRYN DGASGRMSGN AIELDARGRY FAASVGFARS       540
     LERPSAIERR EHPIYFRVDA FF                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page