(data stored in ACNUC7421 zone)

EMBL: CP000438.PE411

CP000438.PE411       Location/Qualifiers
FT   CDS             complement(448962..449555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05130"
FT                   /product="putative YGGT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15359"
FT                   /db_xref="GOA:A0A0H2ZKH5"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH5"
FT                   /protein_id="ABJ15359.1"
FT                   /translation="MIGLNTAAIYILQTLGSLYLLIVLLRFILQLVRADFYNPLSQFIV
FT                   RATKPLLNPLRRIIPGFGGIDLASLVLAILIQLVLMILILMLMGYGVGGFIMQLLIWSI
FT                   IAVTSLFLKVFFFALIISVILSWVAPGSYNPGAQLVNQICEPLLMPFRKLLPNLGGLDL
FT                   SPIFAFLALKLIDMLVINNLAAMTGMPQQLSIFL"
     MIGLNTAAIY ILQTLGSLYL LIVLLRFILQ LVRADFYNPL SQFIVRATKP LLNPLRRIIP        60
     GFGGIDLASL VLAILIQLVL MILILMLMGY GVGGFIMQLL IWSIIAVTSL FLKVFFFALI       120
     ISVILSWVAP GSYNPGAQLV NQICEPLLMP FRKLLPNLGG LDLSPIFAFL ALKLIDMLVI       180
     NNLAAMTGMP QQLSIFL                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page