(data stored in ACNUC7421 zone)

EMBL: CP000438.PE413

CP000438.PE413       Location/Qualifiers
FT   CDS             complement(450399..451091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05160"
FT                   /product="putative PLP dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15361"
FT                   /db_xref="GOA:A0A0H2ZL20"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL20"
FT                   /protein_id="ABJ15361.1"
FT                   /translation="MSTIAENIAKVAARIREAAQAAGRDPATVGLLAVSKTKPAAAVRE
FT                   AHAAGLRDFGENYLQEALGKQAELADLPLNWHFIGPIQSNKTRPIAEHFQWVHSVDRLK
FT                   IAQRLSEQRPAGLPLLNVCLQVNVSGEASKSGCAPEDLPALAEAVKQLPNLRLRGLMAI
FT                   PEPTAERAAQHAAFARLRELLLDLNLGLDTLSMGMSDDLEAAIGEGATWVRIGTALFGA
FT                   RDYGAPAS"
     MSTIAENIAK VAARIREAAQ AAGRDPATVG LLAVSKTKPA AAVREAHAAG LRDFGENYLQ        60
     EALGKQAELA DLPLNWHFIG PIQSNKTRPI AEHFQWVHSV DRLKIAQRLS EQRPAGLPLL       120
     NVCLQVNVSG EASKSGCAPE DLPALAEAVK QLPNLRLRGL MAIPEPTAER AAQHAAFARL       180
     RELLLDLNLG LDTLSMGMSD DLEAAIGEGA TWVRIGTALF GARDYGAPAS                  230
//

If you have problems or comments...

PBIL Back to PBIL home page