(data stored in ACNUC7421 zone)

EMBL: CP000438.PE417

CP000438.PE417       Location/Qualifiers
FT   CDS             454728..455132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05210"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15365"
FT                   /db_xref="GOA:A0A0H2ZK47"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK47"
FT                   /protein_id="ABJ15365.1"
FT                   /translation="MTQQHDTHSKAIGYLLWIFGFTGSHRFYYGKPITGTIWFFTFGLF
FT                   FIGWIIDLFLIPSMDREADRRFQGGNLDYNVAWILLTFLGVLGVHRMYMGKWITGIIYL
FT                   FTGGLFFLGVLYDFWTLNGQVSERNGPQRI"
     MTQQHDTHSK AIGYLLWIFG FTGSHRFYYG KPITGTIWFF TFGLFFIGWI IDLFLIPSMD        60
     READRRFQGG NLDYNVAWIL LTFLGVLGVH RMYMGKWITG IIYLFTGGLF FLGVLYDFWT       120
     LNGQVSERNG PQRI                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page