(data stored in ACNUC7421 zone)

EMBL: CP000438.PE425

CP000438.PE425       Location/Qualifiers
FT   CDS             complement(462129..463088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05300"
FT                   /product="putative tonB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15373"
FT                   /db_xref="GOA:A0A0H2ZKI4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI4"
FT                   /protein_id="ABJ15373.1"
FT                   /translation="MRHRLFRPPSADFAPRQPPRSAMNAAVLKSPSAAAGVRPADRLGF
FT                   TLFIAAILHVAFILGVGFSMPAPSQISKTLEITLATFKSDKAPEKADYLAQMNQQGSGT
FT                   LEHKAAPKTTEVAPFQDNQVKKVAPPATPKQARSEEAPKAAVTTTRQRQQKAPSKTQAQ
FT                   KAEQVAKPAPHFDSTQLSAEIASLEADLAKEQQAYAKRPRIHRLSAASTMRDKGAWYKE
FT                   DWRKKIERIGNLNYPDEARRQKLYGSLRLLVSINRDGTIYEVQVLESSGEPILDQAAQR
FT                   IVRLAAPYAPFSGDLADIDRLEIIRTWRFERGDRLSSK"
     MRHRLFRPPS ADFAPRQPPR SAMNAAVLKS PSAAAGVRPA DRLGFTLFIA AILHVAFILG        60
     VGFSMPAPSQ ISKTLEITLA TFKSDKAPEK ADYLAQMNQQ GSGTLEHKAA PKTTEVAPFQ       120
     DNQVKKVAPP ATPKQARSEE APKAAVTTTR QRQQKAPSKT QAQKAEQVAK PAPHFDSTQL       180
     SAEIASLEAD LAKEQQAYAK RPRIHRLSAA STMRDKGAWY KEDWRKKIER IGNLNYPDEA       240
     RRQKLYGSLR LLVSINRDGT IYEVQVLESS GEPILDQAAQ RIVRLAAPYA PFSGDLADID       300
     RLEIIRTWRF ERGDRLSSK                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page