(data stored in ACNUC7421 zone)

EMBL: CP000438.PE437

CP000438.PE437       Location/Qualifiers
FT   CDS             complement(479319..480734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL36"
FT                   /protein_id="ABJ15385.1"
FT                   /translation="MNTVAQPTSQRIARMDTPVTFDWKIRLPDVLGVLRRDYAGRFPQL
FT                   ASAALETLLERLRDDLPEDFLPALGQELESLGLALVERLDEDDSLNLYVVGATHSQRLL
FT                   DALAAQGHNARTLRQENAPEGARAALPAAAPAGLAPASAYICLEHAEHLAPGLAIARLP
FT                   GEDSRNLLDLRQWPRLQRLPDGAEETQGALLCRASSADGLHAWVRMTRSGSPYAWLHRS
FT                   RDLASLTPELPPLPLPPAQSLRQRRTPELAIGLAGDDLLLADRGLFFLYPGFAQGNDEP
FT                   RLLFEVPQARHSIENPPAVFTTPDQRVCLLSRGQFFEWREARIQPLPFPVGKDLPADPA
FT                   QPTSAAPGTIVWLERETLCEGRLDSGEIRSHSLDGLAEGPYLKLQALDGGWLLLAPWLE
FT                   PHRSRDLAQLWHLESGRALRIRYGELDLEGGLQHWAELPDGRIVVGDHARHVDLGRFES
FT                   LRQRLLRRRLAPA"
     MNTVAQPTSQ RIARMDTPVT FDWKIRLPDV LGVLRRDYAG RFPQLASAAL ETLLERLRDD        60
     LPEDFLPALG QELESLGLAL VERLDEDDSL NLYVVGATHS QRLLDALAAQ GHNARTLRQE       120
     NAPEGARAAL PAAAPAGLAP ASAYICLEHA EHLAPGLAIA RLPGEDSRNL LDLRQWPRLQ       180
     RLPDGAEETQ GALLCRASSA DGLHAWVRMT RSGSPYAWLH RSRDLASLTP ELPPLPLPPA       240
     QSLRQRRTPE LAIGLAGDDL LLADRGLFFL YPGFAQGNDE PRLLFEVPQA RHSIENPPAV       300
     FTTPDQRVCL LSRGQFFEWR EARIQPLPFP VGKDLPADPA QPTSAAPGTI VWLERETLCE       360
     GRLDSGEIRS HSLDGLAEGP YLKLQALDGG WLLLAPWLEP HRSRDLAQLW HLESGRALRI       420
     RYGELDLEGG LQHWAELPDG RIVVGDHARH VDLGRFESLR QRLLRRRLAP A                471
//

If you have problems or comments...

PBIL Back to PBIL home page