(data stored in ACNUC7421 zone)

EMBL: CP000438.PE438

CP000438.PE438       Location/Qualifiers
FT   CDS             complement(480769..481491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15386"
FT                   /db_xref="GOA:A0A0H2ZKX2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX2"
FT                   /protein_id="ABJ15386.1"
FT                   /translation="MRLSRFFVDQPLALGQHDLPETQAHYIGRVLRHATGDAVQLFDGS
FT                   GREYLGELVEVGKKNVRVELREQFAGQPDSPLRIHLGQGLSRGERMDWAIQKATELGVA
FT                   EITPIVSERCEVRLKDERADKRLQHWRQVAISACEQCGRSSLPLIHPPLALEDWLRGRD
FT                   DELRLVLHPVAAPLASHVPPSRLAFLVGPKGGLSDAEVEQAKAAGFHAARLGPRVLRTE
FT                   TAPVVALAVAQQLWGDFA"
     MRLSRFFVDQ PLALGQHDLP ETQAHYIGRV LRHATGDAVQ LFDGSGREYL GELVEVGKKN        60
     VRVELREQFA GQPDSPLRIH LGQGLSRGER MDWAIQKATE LGVAEITPIV SERCEVRLKD       120
     ERADKRLQHW RQVAISACEQ CGRSSLPLIH PPLALEDWLR GRDDELRLVL HPVAAPLASH       180
     VPPSRLAFLV GPKGGLSDAE VEQAKAAGFH AARLGPRVLR TETAPVVALA VAQQLWGDFA       240
//

If you have problems or comments...

PBIL Back to PBIL home page