(data stored in ACNUC7421 zone)

EMBL: CP000438.PE44

CP000438.PE44        Location/Qualifiers
FT   CDS             54909..55304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIY3"
FT                   /protein_id="ABJ15000.1"
FT                   /translation="MPVLALRLTALAALAISVSGCVMEAYGSRARSDAQSWIGLPIQDV
FT                   IKRFGEPERVTGDAARQKYVWKEYENYSHDYDYTYYEQGHGNTPNSSVLNQKTGTANQS
FT                   GYYTCIYEFFADASGRVVDATARGECR"
     MPVLALRLTA LAALAISVSG CVMEAYGSRA RSDAQSWIGL PIQDVIKRFG EPERVTGDAA        60
     RQKYVWKEYE NYSHDYDYTY YEQGHGNTPN SSVLNQKTGT ANQSGYYTCI YEFFADASGR       120
     VVDATARGEC R                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page