(data stored in ACNUC7421 zone)

EMBL: CP000438.PE448

CP000438.PE448       Location/Qualifiers
FT   CDS             complement(494807..495877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL45"
FT                   /protein_id="ABJ15396.1"
FT                   /translation="MANSRKHLIYLVYGRQTYHQEALFSIASAFAHLRDGAAHGLTVRV
FT                   YTDDPSPYAGLPVQVREVTAEELVAWCQPHGYHFRAKHVALRDALEDADQALLIDTDTF
FT                   FHSSPLRLFDRIQPGSLLCNAIGARYGEHRNFPLYRDLSPYLFERGWADDEMHQLNSGV
FT                   IGLPREEAKILDRSLELMDELYPIANGAYTLEEFVLAVAAHKRLELVGCTDLIHHYWSR
FT                   KQLFRAKIQAWLCKHGSSLLSAAALDDTLKVTDRLPRPPRAKRLLYKLGTLPLPAPMRQ
FT                   FSIELLYGCHEYSNEFDRACGPVWWEKAATNAIERYPQEPIAEQIEDWLNHSLLRNLLG
FT                   SRANEIRQHLRQRDLL"
     MANSRKHLIY LVYGRQTYHQ EALFSIASAF AHLRDGAAHG LTVRVYTDDP SPYAGLPVQV        60
     REVTAEELVA WCQPHGYHFR AKHVALRDAL EDADQALLID TDTFFHSSPL RLFDRIQPGS       120
     LLCNAIGARY GEHRNFPLYR DLSPYLFERG WADDEMHQLN SGVIGLPREE AKILDRSLEL       180
     MDELYPIANG AYTLEEFVLA VAAHKRLELV GCTDLIHHYW SRKQLFRAKI QAWLCKHGSS       240
     LLSAAALDDT LKVTDRLPRP PRAKRLLYKL GTLPLPAPMR QFSIELLYGC HEYSNEFDRA       300
     CGPVWWEKAA TNAIERYPQE PIAEQIEDWL NHSLLRNLLG SRANEIRQHL RQRDLL           356
//

If you have problems or comments...

PBIL Back to PBIL home page