(data stored in ACNUC7421 zone)

EMBL: CP000438.PE45

CP000438.PE45        Location/Qualifiers
FT   CDS             complement(55575..56984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00550"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15001"
FT                   /db_xref="GOA:A0A0H2ZJW4"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW4"
FT                   /protein_id="ABJ15001.1"
FT                   /translation="MRLHRGGEPDGYRRQRRPHGGRRTTVQAPRGRLLLWCAQARRHPL
FT                   SRRMESSMTLSLDLLLSLCTALAIGLLIGAERGWQERDHEDARQIAGIRTFSLAGLLGG
FT                   FATLLAGELGSAVWVALLLALAALAVAGYVSDVRRGGDQGMTTEIALLMTFLLGSLALT
FT                   EQRLLAAAGGIVLTLLLSLKDKLHALLKRLTAEELSGTLKLLFISVVLLPVLPNQGYGP
FT                   WAFFNPYLTWWMVVLIAALGFSAYLAIRLIGSRKGLLLTAVLGGLVSSTVMTLTLARLR
FT                   ERMPDALLACALLATSALMFPRILVEIGAIHPALLKELVLPFAATTLVYLGGTLFHALR
FT                   GGRASQEAPDEPGLRNPFELLPALRFAALLSAILLLVEVGRRLFGDAGIYAVALLSGLA
FT                   DVDAITLSLARAAQGELDPGVASRGIALAALSNSLVKAGLIVLVGGKRLALQTLPFSLA
FT                   GLLVGALLILL"
     MRLHRGGEPD GYRRQRRPHG GRRTTVQAPR GRLLLWCAQA RRHPLSRRME SSMTLSLDLL        60
     LSLCTALAIG LLIGAERGWQ ERDHEDARQI AGIRTFSLAG LLGGFATLLA GELGSAVWVA       120
     LLLALAALAV AGYVSDVRRG GDQGMTTEIA LLMTFLLGSL ALTEQRLLAA AGGIVLTLLL       180
     SLKDKLHALL KRLTAEELSG TLKLLFISVV LLPVLPNQGY GPWAFFNPYL TWWMVVLIAA       240
     LGFSAYLAIR LIGSRKGLLL TAVLGGLVSS TVMTLTLARL RERMPDALLA CALLATSALM       300
     FPRILVEIGA IHPALLKELV LPFAATTLVY LGGTLFHALR GGRASQEAPD EPGLRNPFEL       360
     LPALRFAALL SAILLLVEVG RRLFGDAGIY AVALLSGLAD VDAITLSLAR AAQGELDPGV       420
     ASRGIALAAL SNSLVKAGLI VLVGGKRLAL QTLPFSLAGL LVGALLILL                   469
//

If you have problems or comments...

PBIL Back to PBIL home page