(data stored in ACNUC7421 zone)

EMBL: CP000438.PE450

CP000438.PE450       Location/Qualifiers
FT   CDS             complement(496862..497416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05600"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15398"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB9"
FT                   /protein_id="ABJ15398.1"
FT                   /translation="MSAPTMSTHLADRYNQAWLFAARAHRNQTLSGSPLPYLVHLGMVA
FT                   NELLAADRDGAIERLGETLQIAVLHDTLEDTATSPEELRQQFGEFVCAGVQALSKRVGD
FT                   GPKRSLDDYLQALAEGPAQYALVKLCDRITNLQPPPQTWSQDKIANYHQESQLILARLG
FT                   HAHAATARRLREKIEHYRQYY"
     MSAPTMSTHL ADRYNQAWLF AARAHRNQTL SGSPLPYLVH LGMVANELLA ADRDGAIERL        60
     GETLQIAVLH DTLEDTATSP EELRQQFGEF VCAGVQALSK RVGDGPKRSL DDYLQALAEG       120
     PAQYALVKLC DRITNLQPPP QTWSQDKIAN YHQESQLILA RLGHAHAATA RRLREKIEHY       180
     RQYY                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page