(data stored in ACNUC7421 zone)

EMBL: CP000438.PE452

CP000438.PE452       Location/Qualifiers
FT   CDS             499155..499589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15400"
FT                   /db_xref="GOA:A0A0H2ZKK1"
FT                   /db_xref="InterPro:IPR021333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKK1"
FT                   /protein_id="ABJ15400.1"
FT                   /translation="MLECAVMRIAPISRSPLLQWLSFALCACVLVNALACGVLHLQALG
FT                   VGSDKGQKASVGLFCVAGASQWLSLDPDDGSAGDPVPVNPQLPVSCPMCSALVLFVALG
FT                   VIWSWRLQRRRQARFRPPATREPVPPRYVWPPANPRASPA"
     MLECAVMRIA PISRSPLLQW LSFALCACVL VNALACGVLH LQALGVGSDK GQKASVGLFC        60
     VAGASQWLSL DPDDGSAGDP VPVNPQLPVS CPMCSALVLF VALGVIWSWR LQRRRQARFR       120
     PPATREPVPP RYVWPPANPR ASPA                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page