(data stored in ACNUC7421 zone)

EMBL: CP000438.PE454

CP000438.PE454       Location/Qualifiers
FT   CDS             501918..503396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05650"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15402"
FT                   /db_xref="GOA:A0A0H2ZL52"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL52"
FT                   /protein_id="ABJ15402.1"
FT                   /translation="MKRYLYLWHRWLGIGCCLLMVLWFVSGMVMLYVGYPKLTPLERLA
FT                   HLPELDGCEACVPLRTALAGGDGKTPRSIRLASVGGLPTYLLDDADGRTRALAARDGRP
FT                   LAVDADRVLASARAFSGEVPMQLQGRIEEDAWTHTRNLDPHRPLWRVQTADEEGRLLYL
FT                   SSQTGEVVRDASRRERAWNWLGAWLHWLYPLRGGWFDGQWANLVIGLSLLATLATVLGI
FT                   LVGLLRWRFRKPYRSGSRSPYAGGFQRWHHLAGLLFGALVLSWIFSGLMSMNPWNLFGR
FT                   GTPLDLAAYQGGSWDRALPAGLEADAVLRRLRAAGLRVRELEWRALDGEPYALGRSASG
FT                   NSLLLTADGEILRELPADRLLAAARALLPGVPMQAERLERYDFYYYPREEHSMMGYLER
FT                   RLPVWRLRFDDPRHTWVHLDPYSGAVVGVLDDGRRGSRWLFSLLHSWDWLPLLTRRPLW
FT                   DLWMLGFSLGGLVVCASGCWIGWRRLRGRRPKRR"
     MKRYLYLWHR WLGIGCCLLM VLWFVSGMVM LYVGYPKLTP LERLAHLPEL DGCEACVPLR        60
     TALAGGDGKT PRSIRLASVG GLPTYLLDDA DGRTRALAAR DGRPLAVDAD RVLASARAFS       120
     GEVPMQLQGR IEEDAWTHTR NLDPHRPLWR VQTADEEGRL LYLSSQTGEV VRDASRRERA       180
     WNWLGAWLHW LYPLRGGWFD GQWANLVIGL SLLATLATVL GILVGLLRWR FRKPYRSGSR       240
     SPYAGGFQRW HHLAGLLFGA LVLSWIFSGL MSMNPWNLFG RGTPLDLAAY QGGSWDRALP       300
     AGLEADAVLR RLRAAGLRVR ELEWRALDGE PYALGRSASG NSLLLTADGE ILRELPADRL       360
     LAAARALLPG VPMQAERLER YDFYYYPREE HSMMGYLERR LPVWRLRFDD PRHTWVHLDP       420
     YSGAVVGVLD DGRRGSRWLF SLLHSWDWLP LLTRRPLWDL WMLGFSLGGL VVCASGCWIG       480
     WRRLRGRRPK RR                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page