(data stored in ACNUC7421 zone)

EMBL: CP000438.PE467

CP000438.PE467       Location/Qualifiers
FT   CDS             518460..518864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05860"
FT                   /product="putative long-chain acyl-CoA thioester hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05860"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15414"
FT                   /db_xref="GOA:A0A0H2ZLD3"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD3"
FT                   /protein_id="ABJ15414.1"
FT                   /translation="MNFHTRKWVKPEDLNPNGTLFGGSLLRWIDEEAAIYAIIQLGNQR
FT                   VVTKYISEINFVSSARQGDIIELGITATDFGRTSLTMTCHVRNKITRKSILTIDKMVFV
FT                   NLGPDGLPAPHGKTEITYIKDQFKEDEVLP"
     MNFHTRKWVK PEDLNPNGTL FGGSLLRWID EEAAIYAIIQ LGNQRVVTKY ISEINFVSSA        60
     RQGDIIELGI TATDFGRTSL TMTCHVRNKI TRKSILTIDK MVFVNLGPDG LPAPHGKTEI       120
     TYIKDQFKED EVLP                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page