(data stored in ACNUC7421 zone)

EMBL: CP000438.PE470

CP000438.PE470       Location/Qualifiers
FT   CDS             522237..523031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05890"
FT                   /product="putative stomatin-like transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05890"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15417"
FT                   /db_xref="GOA:A0A0H2ZL69"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL69"
FT                   /protein_id="ABJ15417.1"
FT                   /translation="MMGISYGLAMLLVFLALLLFSALRILREYERGVVFQLGRFWKVKG
FT                   PGLVLVIPAIQQMVRIDLRTIVLDVPPQDVISRDNVSVKVNAVVYFRVLDPQKAIIQVE
FT                   NYLAATSQLAQTTLRAVLGKHELDEMLAERERLNLDIQQVLDAQTDAWGIKVANVEIKH
FT                   VDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLGRQSGAMQLRYMQT
FT                   LGAIAGDKSSTIVFPMPIELFGGKYAGAAPRNEKAAGEDEER"
     MMGISYGLAM LLVFLALLLF SALRILREYE RGVVFQLGRF WKVKGPGLVL VIPAIQQMVR        60
     IDLRTIVLDV PPQDVISRDN VSVKVNAVVY FRVLDPQKAI IQVENYLAAT SQLAQTTLRA       120
     VLGKHELDEM LAERERLNLD IQQVLDAQTD AWGIKVANVE IKHVDLNESM VRAIARQAEA       180
     ERERRAKVIH AEGELQASEK LMQAAQMLGR QSGAMQLRYM QTLGAIAGDK SSTIVFPMPI       240
     ELFGGKYAGA APRNEKAAGE DEER                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page