(data stored in ACNUC7421 zone)

EMBL: CP000438.PE472

CP000438.PE472       Location/Qualifiers
FT   CDS             complement(523867..526068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05920"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05920"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15419"
FT                   /db_xref="GOA:A0A0H2ZLD9"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD9"
FT                   /protein_id="ABJ15419.1"
FT                   /translation="MPPSSLTHTLRRLWALDKFAYSLRVFIALAGALLLCWWQDRIELL
FT                   IPLFLGIIASALAETDDNWLGRLQALLVTLLCFSVAAFAVELLFPYPWLFVSGMALSAF
FT                   GMILLGALGERYAAIASATLILSIYTMIGVDQRGGEVADVWHEPLLLVAGAAWYGLLSV
FT                   LWNALFSNQPVQQSLSRLYFELGEYLRIKSSLFEPLRQLDVEGQRLALARQNGKVVVAL
FT                   NQAKETILNRLGHGRPGPKVSRYLKLYFIAQDVHERASSSHYPYNRLAEAFFHSDVLFR
FT                   CQRLLNQQGKACQALARAIRLRQPFDYADRELALEDLQASLEHLRQQSNPAWKGLLRSL
FT                   GALAANLTTLDRKLAGASNPDAIADEQDSALLDRSPRSLKDAFERLRQQLTPTSLLFRH
FT                   GLRMALALTAGYGVLHWIHPTQGYWILLTTVFVCQPNYGATRLRLVQRILGTVVGLVVG
FT                   WALIDLFPSPLVQSLFAVAAGVAFFATRSSRYTLATAAITLLVLFCFNQVGDGYGLILP
FT                   RLFDTLLGSLIAGLAVFLVLPDWQGRRLNRMLANTLACNSRYLRQIMQQYATGKRDDLD
FT                   YRTARRNAHNADAALSTTLSNMLLEPGHFRKDAEIGFRFLVLSHTLLSYLSGLGAHRES
FT                   LPEDASDGLLERAAERLSASLEEIAASLEQKRPVAIYSEEEEALAKELEQMPEDMDDSH
FT                   RLVQTQLAHICRQLAPLRTLAAHLLKKELAGAQPLPGQP"
     MPPSSLTHTL RRLWALDKFA YSLRVFIALA GALLLCWWQD RIELLIPLFL GIIASALAET        60
     DDNWLGRLQA LLVTLLCFSV AAFAVELLFP YPWLFVSGMA LSAFGMILLG ALGERYAAIA       120
     SATLILSIYT MIGVDQRGGE VADVWHEPLL LVAGAAWYGL LSVLWNALFS NQPVQQSLSR       180
     LYFELGEYLR IKSSLFEPLR QLDVEGQRLA LARQNGKVVV ALNQAKETIL NRLGHGRPGP       240
     KVSRYLKLYF IAQDVHERAS SSHYPYNRLA EAFFHSDVLF RCQRLLNQQG KACQALARAI       300
     RLRQPFDYAD RELALEDLQA SLEHLRQQSN PAWKGLLRSL GALAANLTTL DRKLAGASNP       360
     DAIADEQDSA LLDRSPRSLK DAFERLRQQL TPTSLLFRHG LRMALALTAG YGVLHWIHPT       420
     QGYWILLTTV FVCQPNYGAT RLRLVQRILG TVVGLVVGWA LIDLFPSPLV QSLFAVAAGV       480
     AFFATRSSRY TLATAAITLL VLFCFNQVGD GYGLILPRLF DTLLGSLIAG LAVFLVLPDW       540
     QGRRLNRMLA NTLACNSRYL RQIMQQYATG KRDDLDYRTA RRNAHNADAA LSTTLSNMLL       600
     EPGHFRKDAE IGFRFLVLSH TLLSYLSGLG AHRESLPEDA SDGLLERAAE RLSASLEEIA       660
     ASLEQKRPVA IYSEEEEALA KELEQMPEDM DDSHRLVQTQ LAHICRQLAP LRTLAAHLLK       720
     KELAGAQPLP GQP                                                          733
//

If you have problems or comments...

PBIL Back to PBIL home page