(data stored in ACNUC7421 zone)

EMBL: CP000438.PE475

CP000438.PE475       Location/Qualifiers
FT   CDS             528414..528938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_05970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15422"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL74"
FT                   /protein_id="ABJ15422.1"
FT                   /translation="MKPVQSRRLAFAALLSLSFSSASCHAATEHWGWIEQSWLMPERMQ
FT                   AKAKLDTGALTSSLDARNIHRYKKDGERWVRFDVVLPTADSKAPVSVTFERKVLRLIKV
FT                   RGAGGSDSRPVVAMDICLGAKLLREQFSLRDRGNMNYPVLLGRRTLEHLGAVDVSRTFT
FT                   RKPTCSALAAQ"
     MKPVQSRRLA FAALLSLSFS SASCHAATEH WGWIEQSWLM PERMQAKAKL DTGALTSSLD        60
     ARNIHRYKKD GERWVRFDVV LPTADSKAPV SVTFERKVLR LIKVRGAGGS DSRPVVAMDI       120
     CLGAKLLREQ FSLRDRGNMN YPVLLGRRTL EHLGAVDVSR TFTRKPTCSA LAAQ             174
//

If you have problems or comments...

PBIL Back to PBIL home page