(data stored in ACNUC7421 zone)

EMBL: CP000438.PE480

CP000438.PE480       Location/Qualifiers
FT   CDS             535279..535983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15426"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK97"
FT                   /protein_id="ABJ15426.1"
FT                   /translation="MLRSSRRLLVRPVNSSRMVGFPVLGVGRRGPSYASAPRRPSRRRG
FT                   ERNRAVLVLCGPRITSGDARVKRALALLSLFALPVLAAEPNLYGRYEWVSLPELDRTLQ
FT                   AKMDTGAYTSSLSAKDIELFQRDGEEWVRFRLATKEADGSVFEHKLARIGKIKNRADNR
FT                   NGEDEDEDRLSERPVIDLQVCLGGAMKTIEVNLTDRSAFNYPFLMGTKGLRKFHVAVDP
FT                   SERFVADKPTCK"
     MLRSSRRLLV RPVNSSRMVG FPVLGVGRRG PSYASAPRRP SRRRGERNRA VLVLCGPRIT        60
     SGDARVKRAL ALLSLFALPV LAAEPNLYGR YEWVSLPELD RTLQAKMDTG AYTSSLSAKD       120
     IELFQRDGEE WVRFRLATKE ADGSVFEHKL ARIGKIKNRA DNRNGEDEDE DRLSERPVID       180
     LQVCLGGAMK TIEVNLTDRS AFNYPFLMGT KGLRKFHVAV DPSERFVADK PTCK             234
//

If you have problems or comments...

PBIL Back to PBIL home page