(data stored in ACNUC7421 zone)

EMBL: CP000438.PE484

CP000438.PE484       Location/Qualifiers
FT   CDS             539691..539993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15431"
FT                   /db_xref="GOA:A0A0H2ZKA2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA2"
FT                   /protein_id="ABJ15431.1"
FT                   /translation="MRLFFEFTLCAALGLLVSGVILIFLLFFGKFGLIEYWIASGKPLA
FT                   HAMLVLMPDGFWEGLSGIEGAAGNPHVRSFLELCMGLGQSALLLGLLLFRLVCWK"
     MRLFFEFTLC AALGLLVSGV ILIFLLFFGK FGLIEYWIAS GKPLAHAMLV LMPDGFWEGL        60
     SGIEGAAGNP HVRSFLELCM GLGQSALLLG LLLFRLVCWK                             100
//

If you have problems or comments...

PBIL Back to PBIL home page