(data stored in ACNUC7421 zone)

EMBL: CP000438.PE487

CP000438.PE487       Location/Qualifiers
FT   CDS             541813..542670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06150"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15434"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLF5"
FT                   /protein_id="ABJ15434.1"
FT                   /translation="MATVEILGAECRAGGAVNDDALGCTAQAAWVIDGATSIGRSVLGV
FT                   ESDARWLAQAVDRHLRLLLEVEPEQSSETLLRRLLNDIQGDFRAQSGRDWHDLEDMPAA
FT                   CLSLLRIRGGEIELLNIGDSRILVEGADGQVRSFGDSALYELDRQSLAHFCRMREEHPQ
FT                   WDHAELFKASRPRVRQNRLLMNKPEGYWALDISDRWLGQVQRETLPLAALRSFVLMTDG
FT                   FDRLVEPFRRYTDEQLLRRLEDVGVSAMLDELREIEQGDDQALAFPRFKIHDDASALWG
FT                   RIAG"
     MATVEILGAE CRAGGAVNDD ALGCTAQAAW VIDGATSIGR SVLGVESDAR WLAQAVDRHL        60
     RLLLEVEPEQ SSETLLRRLL NDIQGDFRAQ SGRDWHDLED MPAACLSLLR IRGGEIELLN       120
     IGDSRILVEG ADGQVRSFGD SALYELDRQS LAHFCRMREE HPQWDHAELF KASRPRVRQN       180
     RLLMNKPEGY WALDISDRWL GQVQRETLPL AALRSFVLMT DGFDRLVEPF RRYTDEQLLR       240
     RLEDVGVSAM LDELREIEQG DDQALAFPRF KIHDDASALW GRIAG                       285
//

If you have problems or comments...

PBIL Back to PBIL home page