(data stored in ACNUC7421 zone)

EMBL: CP000438.PE499

CP000438.PE499       Location/Qualifiers
FT   CDS             554467..554910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06280"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15446"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB8"
FT                   /protein_id="ABJ15446.1"
FT                   /translation="MNEPGSFIWTWYGQDEHRWVLLSAEAFLALDFLALDGAMQRETIG
FT                   SCPGCSTWSEKIVPLHEWLEGCPGHQAGNFRDALRRVWALCNELPEEALGCFDFDIYAH
FT                   PGWQAVRREAREALRQNGWDSIRSHAEELRDDCWERVHGYPKK"
     MNEPGSFIWT WYGQDEHRWV LLSAEAFLAL DFLALDGAMQ RETIGSCPGC STWSEKIVPL        60
     HEWLEGCPGH QAGNFRDALR RVWALCNELP EEALGCFDFD IYAHPGWQAV RREAREALRQ       120
     NGWDSIRSHA EELRDDCWER VHGYPKK                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page