(data stored in ACNUC7421 zone)

EMBL: CP000438.PE504

CP000438.PE504       Location/Qualifiers
FT   CDS             complement(560220..561194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_06330"
FT                   /product="putative putative homoserine kinase type II"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15451"
FT                   /db_xref="GOA:A0A0H2ZKP1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP1"
FT                   /protein_id="ABJ15451.1"
FT                   /translation="MSHPFDQLTPDLVLDAVESLGYLSDARVLALNSYENRVYQVGIED
FT                   GEPLIAKFYRPDRWSDAAIREEHAFSAELAECEVPVVAPLSRDGESLFAFAGFRFALFP
FT                   RRGGRAPEPGNLDQLYRLGQLLGRLHAVGATRPFEHREALAVDNFGHASLATLLEGNFI
FT                   PRSLLPAYESVARDLLKRLDALFAEVPYQPIRLHGDCHPGNLLCRDEVYHMVDLDDCRM
FT                   GPALQDLWMMLAGERHERLAQIAELVDGYNEFHDFDPRQLPLLEGLRSLRLMHYSAWLA
FT                   RRWDDPAFPPSFPWFGSERYWGEQVLVLREQLAALDEEPLRLF"
     MSHPFDQLTP DLVLDAVESL GYLSDARVLA LNSYENRVYQ VGIEDGEPLI AKFYRPDRWS        60
     DAAIREEHAF SAELAECEVP VVAPLSRDGE SLFAFAGFRF ALFPRRGGRA PEPGNLDQLY       120
     RLGQLLGRLH AVGATRPFEH REALAVDNFG HASLATLLEG NFIPRSLLPA YESVARDLLK       180
     RLDALFAEVP YQPIRLHGDC HPGNLLCRDE VYHMVDLDDC RMGPALQDLW MMLAGERHER       240
     LAQIAELVDG YNEFHDFDPR QLPLLEGLRS LRLMHYSAWL ARRWDDPAFP PSFPWFGSER       300
     YWGEQVLVLR EQLAALDEEP LRLF                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page